LL-37: The Antimicrobial & Innate Immune Protocol
Disclaimer: This article is for educational and research purposes only. LL-37 is a potent antimicrobial peptide (AMP) currently under investigation for wound healing and immune modulation. It is not approved by the FDA for human use. Information reflects current 2025/2026 clinical research data.
What is LL-37?
LL-37 is the only member of the Cathelicidin family of antimicrobial peptides found in humans. It is naturally produced by various cells, including macrophages, neutrophils, and epithelial cells, as a first-line defense against infection.
In a research setting, LL-37 is unique because it doesn't just act as an "antibiotic"; it acts as a signaling molecule that coordinates the immune response, promotes tissue repair, and modulates inflammation.
- Molecular Formula: $C_{205}H_{340}N_{60}O_{53}$
- Sequence: [LL-37, 37 aa]
- Primary Target: Bacterial membranes and Formyl peptide receptor-like 1 (FPRL1).
Mechanism of Action: The "Membrane Disruptor"
LL-37 works through a multi-faceted approach to cellular defense:
- Direct Antimicrobial Activity: It has a "hole-punching" effect on the membranes of Gram-negative and Gram-positive bacteria, fungi, and certain viruses.
- Biofilm Disruption: Research shows LL-37 can penetrate and break down bacterial biofilms, which are notoriously resistant to standard antibiotics.
- Angiogenesis: It promotes the formation of new blood vessels, which is critical for the research of chronic wound healing and tissue regeneration.
- LPS Neutralization: It binds to Lipopolysaccharides (LPS), effectively neutralizing the toxic "endotoxins" released by bacteria that cause systemic inflammation.
Current Research Landscape (2024–2026)
Key Study Findings
| Focus Area | Primary Outcome | Reference |
| Chronic Wounds | Accelerated healing in venous leg ulcers and diabetic foot ulcers. | Journal of Investigative Dermatology |
| Gut Health | Investigated for its ability to balance the intestinal microbiota. | Gastroenterology Research (2025) |
| Autoimmunity | Studies exploring its dual role in Psoriasis and Lupus. | Frontiers in Immunology |
Research Protocols (5mg Vial)
LL-37 is highly potent. Research protocols vary significantly between systemic (SubQ) and topical (wound) applications.
Reconstitution (2 mL BAC Water)
For a 5 mg vial, adding 2 mL of Bacteriostatic Water (BAC) is the standard for precise micro-dosing.
Total Vial: 5,000 mcg (5 mg)
Concentration: 2,500 mcg per 1 mL (25 mcg per unit)
Dosing Schedule (Subcutaneous)
Note: Systemic LL-37 research is typically conducted in short cycles (e.g., 10–20 days).
| Research Level | Daily Dose | Syringe Units (IU) | Days per 5mg Vial |
| Introductory | 100 mcg | 4 Units | 50 Days |
| Standard | 250 mcg | 10 Units | 20 Days |
| Advanced | 500 mcg | 20 Units | 10 Days |
Frequently Asked Questions
Is LL-37 pro-inflammatory or anti-inflammatory?
It is both. LL-37 is an "immunomodulator." In some tissues (like the gut), it helps resolve inflammation, while in others (like the skin in Psoriasis), it may trigger an immune response. This dual nature is the primary focus of current 2026 research.
Can it be used topically?
Yes. In clinical trials for wound healing, LL-37 is often applied as a solution directly to the site of injury. However, for systemic immune modulation research, Subcutaneous (SubQ) is the standard route.
What is the "stinging" sensation?
Because LL-37 is highly cationic (positively charged), it can cause a mild, localized stinging or redness at the injection site. This is typically transient.
How long is it stable?
LL-37 is a robust peptide but should be kept refrigerated (2-8°C). Use the reconstituted vial within 30 days to ensure full antimicrobial potency.
Summary Checklist
- [ ] 1 Vial LL-37 (5 mg).
- [ ] 2 mL Bacteriostatic Water.
- [ ] Subcutaneous injection (Standard) or Topical (Wound research).
- [ ] Storage: Refrigerator only.